BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os02g0243900 Os02g0243900|Os02g0243900
         (241 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G34580.1  | chr2:14566673-14567640 REVERSE LENGTH=163           49   3e-06
>AT2G34580.1 | chr2:14566673-14567640 REVERSE LENGTH=163
          Length = 162

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (78%)

Query: 1  MELSAAFEERVRQMEDARNHRLSLLHAEKELQAERSRLLDTK 42
          M LS+AF+ER+ QME  RN RL+LL AEKELQ  ++++L +K
Sbjct: 1  MALSSAFKERLDQMEFTRNQRLNLLQAEKELQVNKAQILASK 42
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.314    0.125    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 3,031,256
Number of extensions: 82454
Number of successful extensions: 323
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 323
Number of HSP's successfully gapped: 1
Length of query: 241
Length of database: 11,106,569
Length adjustment: 96
Effective length of query: 145
Effective length of database: 8,474,633
Effective search space: 1228821785
Effective search space used: 1228821785
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 110 (47.0 bits)