BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os02g0137700 Os02g0137700|J065061J05
         (46 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT1G16720.1  | chr1:5723161-5726248 FORWARD LENGTH=599             74   2e-14

>AT1G16720.1 | chr1:5723161-5726248 FORWARD LENGTH=599
          Length = 598

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/36 (88%), Positives = 35/36 (97%)

Query: 7   QVRVPFSDFRPVNPQDPPLDPFLVHTLTIRFEPKKQ 42
           +VRVPFS FRPVNP+DPPLDPFLVHTLTIRFEPK+Q
Sbjct: 400 RVRVPFSAFRPVNPEDPPLDPFLVHTLTIRFEPKRQ 435



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.322    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,110,766
Number of extensions: 28930
Number of successful extensions: 65
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 65
Number of HSP's successfully gapped: 1
Length of query: 46
Length of database: 11,106,569
Length adjustment: 20
Effective length of query: 26
Effective length of database: 10,558,249
Effective search space: 274514474
Effective search space used: 274514474
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 104 (44.7 bits)