BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os01g0923000 Os01g0923000|AK070795
         (131 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT1G27290.1  | chr1:9481788-9482576 FORWARD LENGTH=143             60   4e-10
>AT1G27290.1 | chr1:9481788-9482576 FORWARD LENGTH=143
          Length = 142

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 51  MSPAAAATMLLGASVALMLCGSVTFAIGLLLMPWVAGVALLFGLSAAVSTL 101
           +SP+  A++LLG SVALMLCGSVTF IG LLMPWV  + L+F ++  VS +
Sbjct: 64  ISPSGFASLLLGISVALMLCGSVTFFIGFLLMPWVLALILVFYVAGIVSAI 114
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.324    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,467,405
Number of extensions: 26850
Number of successful extensions: 90
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 90
Number of HSP's successfully gapped: 1
Length of query: 131
Length of database: 11,106,569
Length adjustment: 87
Effective length of query: 44
Effective length of database: 8,721,377
Effective search space: 383740588
Effective search space used: 383740588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 106 (45.4 bits)