BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os01g0630300 Os01g0630300|J065098N23
         (174 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G05800.1  | chr3:1727476-1728111 FORWARD LENGTH=212             46   8e-06

>AT3G05800.1 | chr3:1727476-1728111 FORWARD LENGTH=212
          Length = 211

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/47 (59%), Positives = 31/47 (65%)

Query: 112 VAVLRQLVPGGEAMAVERLLDETADYIAALRAQVGVMRALACLLSGL 158
           V VL  LVPG    A+  LLDETADYIAAL  QV  M AL+ +LS L
Sbjct: 155 VRVLGGLVPGCRRTALPELLDETADYIAALEMQVRAMTALSKILSEL 201



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.313    0.129    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,790,954
Number of extensions: 40261
Number of successful extensions: 126
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 128
Number of HSP's successfully gapped: 1
Length of query: 174
Length of database: 11,106,569
Length adjustment: 92
Effective length of query: 82
Effective length of database: 8,584,297
Effective search space: 703912354
Effective search space used: 703912354
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 108 (46.2 bits)