BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os01g0502800 Os01g0502800|AK059957
         (52 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G46020.1  | chr3:16912511-16913250 REVERSE LENGTH=103           48   1e-06

>AT3G46020.1 | chr3:16912511-16913250 REVERSE LENGTH=103
          Length = 102

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%)

Query: 18 AKPFSTEIFVSRLSFYTTEEELKNVFSPFGAVEEA 52
          AK  S ++FVSRLS YTT++ L+ +FSPFG ++EA
Sbjct: 2  AKRISAQLFVSRLSAYTTDQSLRQLFSPFGQIKEA 36



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.321    0.135    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,003,036
Number of extensions: 24906
Number of successful extensions: 197
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 197
Number of HSP's successfully gapped: 1
Length of query: 52
Length of database: 11,106,569
Length adjustment: 25
Effective length of query: 27
Effective length of database: 10,421,169
Effective search space: 281371563
Effective search space used: 281371563
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 105 (45.1 bits)