BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os01g0392100 Os01g0392100|AK107724
         (121 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT3G15780.1  | chr3:5341434-5342351 FORWARD LENGTH=118             48   1e-06
>AT3G15780.1 | chr3:5341434-5342351 FORWARD LENGTH=118
          Length = 117

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (66%)

Query: 77  LSRLQDRIRIFFAVLFWMALFFWGSAWDGNNNSGGTKRQRFR 118
           ++R+QDR++IF AV FWM LFFW +  DG     G K  RF+
Sbjct: 76  VTRVQDRVKIFLAVFFWMFLFFWVTVTDGTGKGKGKKGSRFK 117
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.331    0.143    0.486 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,950,805
Number of extensions: 54270
Number of successful extensions: 143
Number of sequences better than 1.0e-05: 2
Number of HSP's gapped: 143
Number of HSP's successfully gapped: 2
Length of query: 121
Length of database: 11,106,569
Length adjustment: 86
Effective length of query: 35
Effective length of database: 8,748,793
Effective search space: 306207755
Effective search space used: 306207755
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 105 (45.1 bits)