BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os01g0182300 Os01g0182300|AK062827
         (171 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT2G25735.1  | chr2:10975345-10975704 REVERSE LENGTH=120           47   6e-06

>AT2G25735.1 | chr2:10975345-10975704 REVERSE LENGTH=120
          Length = 119

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 128 VPYDAYSYAQNFDDGAAWV---EPENLSRSFSARFAVPSRV 165
           V Y+   Y+ NFD G  W    EPENLSRSFS RFA P+R+
Sbjct: 71  VAYEPCDYSLNFDQGPGWHDHDEPENLSRSFSCRFADPTRI 111



  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.325    0.137    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,589,742
Number of extensions: 64405
Number of successful extensions: 139
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 140
Number of HSP's successfully gapped: 1
Length of query: 171
Length of database: 11,106,569
Length adjustment: 91
Effective length of query: 80
Effective length of database: 8,611,713
Effective search space: 688937040
Effective search space used: 688937040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 108 (46.2 bits)