BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os01g0166500 Os01g0166500|AK122083
         (246 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT5G01790.1  | chr5:305057-305683 REVERSE LENGTH=209               54   1e-07
>AT5G01790.1 | chr5:305057-305683 REVERSE LENGTH=209
          Length = 208

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (77%)

Query: 36 AAAAPSFRVYYGVASAGSVPFLWESQPGTPKNAMSD 71
          +AA PSFR+YY   +AG+VPF WES PGTPK+  S+
Sbjct: 57 SAACPSFRIYYYDGAAGAVPFEWESHPGTPKHPSSE 92
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.323    0.130    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 2,160,717
Number of extensions: 43001
Number of successful extensions: 104
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 104
Number of HSP's successfully gapped: 1
Length of query: 246
Length of database: 11,106,569
Length adjustment: 96
Effective length of query: 150
Effective length of database: 8,474,633
Effective search space: 1271194950
Effective search space used: 1271194950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 110 (47.0 bits)