BLASTP 2.2.23 [Feb-03-2010]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment:
Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schäffer, and Yi-Kuo Yu (2005) "Protein database
searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Os01g0166300 Os01g0166300|J065188L13
         (105 letters)

Database: tair10 
           27,416 sequences; 11,106,569 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AT4G35530.1  | chr4:16871925-16873280 REVERSE LENGTH=196           62   5e-11
>AT4G35530.1 | chr4:16871925-16873280 REVERSE LENGTH=196
          Length = 195

 Score = 62.0 bits (149), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 37/52 (71%)

Query: 37  KATFYSGRVHRQFVPVGKLLKPVLNEHVTPITCYWSLVLLLHSEDKLVRVFK 88
           +  + SG+   +F+P+ K+LKPVL E VTPITCYWSL L L  E++L  VFK
Sbjct: 106 ETQYLSGKTVSRFIPIDKILKPVLVECVTPITCYWSLSLFLRGEEQLTLVFK 157
  Database: tair10
    Posted date:  Dec 8, 2010 11:30 AM
  Number of letters in database: 11,106,569
  Number of sequences in database:  27,416
  
Lambda     K      H
   0.331    0.142    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 27416
Number of Hits to DB: 1,749,222
Number of extensions: 51429
Number of successful extensions: 144
Number of sequences better than 1.0e-05: 1
Number of HSP's gapped: 144
Number of HSP's successfully gapped: 1
Length of query: 105
Length of database: 11,106,569
Length adjustment: 75
Effective length of query: 30
Effective length of database: 9,050,369
Effective search space: 271511070
Effective search space used: 271511070
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 104 (44.7 bits)